PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008083-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 322aa    MW: 36189.3 Da    PI: 8.3781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008083-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-162673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEdell  ++++ G g+W+t +++ g+ R++k+c++rw +yl
    NNU_008083-RA 26 RGPWTPEEDELLSSYIRREGVGRWRTLPKRAGLLRCGKSCRLRWVNYL 73
                     89******************************99************97 PP

2Myb_DNA-binding46.77.1e-1584124648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    NNU_008083-RA  84 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 124
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8372173IPR017930Myb domain
SuperFamilySSF466892.92E-2823120IPR009057Homeodomain-like
SMARTSM007172.7E-122575IPR001005SANT/Myb domain
PfamPF002493.5E-142673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-202780IPR009057Homeodomain-like
CDDcd001675.18E-102873No hitNo description
PROSITE profilePS5129423.03474128IPR017930Myb domain
SMARTSM007171.2E-1378126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2381129IPR009057Homeodomain-like
CDDcd001672.22E-1184124No hitNo description
PfamPF002491.2E-1384124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MRNPSSASAV SSTSKTPCCS KVGLKRGPWT PEEDELLSSY IRREGVGRWR TLPKRAGLLR  60
CGKSCRLRWV NYLRPCVKRG HIAPDEEDLI LRLHRLLGNR WSLIAGRIPG RTDNEIKNYW  120
NTHLSKKLIS QGIDPRTHKP LNPNPNSLED FHTPPPASGL NPIPNLDPNP NSRGLQETGV  180
GDGATTIYKG NKRFREINVN LDQDHSAAFE NSNGNWQKSE GFTISSNLGN NEEGNIDYCT  240
DDAFSSFLNS LINLDVFGNQ EQQQQYQRQQ QPNHLIAPPD PLLNSAQTFG DGALWEAAIT  300
SSTAAFSHDE YKRFIDHVHK HF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23241285108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257627.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388504e-81MYB5_ARATH; Transcription repressor MYB5
TrEMBLQ6Q7891e-123Q6Q789_VITVI; Myb transcription factor
STRINGVIT_08s0007g07230.t011e-122(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-80myb domain protein 5